Mouse Anti-PHOX2A (Paired Mesoderm Homeobox Protein 2A, ARIX1 Homeodomain Protein, Aristaless Homeobox Protein Homolog, Paired-like Homeobox 2A, ARIX, PMX2A)
Phox2a is a transcription factor expressed in noradrenergic cell types of the sympathetic nervous system.
Applications
Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQ
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa1-90 from human PHOX2A (NP_005160) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human PHOX2A. Species Crossreactivity: rat.