Mouse Anti-PLEC1 (Plectin, PCN, PLTN, Hemidesmosomal Protein 1, HD1, Plectin-1, PLEC)
Plectin is a 500kD ubiquitously expressed intermediate filament binding protein and member of the plakin family, which acts as a link between intermediate filaments (IF), microtubules and actin microfilaments within the cytoskeleton, and between the cytoskeleton and plasma membranes connecting different cells, thereby maintaining tissue integrity.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
CGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEA
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa4384-4494 from human PLEC1 (NP_000436) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human PLEC1.