Mouse Anti-PLUNC (BPIFA1, BPI Fold-containing Family A Member 1, Lung-specific Protein X, Nasopharyngeal Carcinoma-related Protein, Palate Lung and Nasal Epithelium Clone Protein, Secretory Protein in Upper Respiratory Tracts, Tracheal Epithelium-enriched Protein, Von Ebner Protein Hl, LUNX, NASG, SPURT, UNQ787/PRO1606, bA49G10.5, LPLUNC3)
May be involved in the airway inflammatory response after exposure to irritants. May be associated with tumor progression. May play a role in innate immune responses of the upper airways.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length recombinant corresponding to aa1-257 from human PLUNC (AAH12549) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human PLUNC.
