Mouse Anti-POGK (KIAA1513, Pogo Transposable Element with KRAB Domain, LST003, SLTP003)
The exact function of the protein encoded by this gene is not known. However, this gene product contains a KRAB domain (which is involved in protein-protein interactions) at the N-terminus, and a transposase domain at the C-terminus, suggesting that it may belong to the family of DNA-mediated transposons in human.
Applications
Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MEIRCHRYGWMTEDLMQDWLEVVWRRRTGAVPKQRGMLILNGFRGHATDSVKNSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAK
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa431-541 from human POGK (NP_060012) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human POGK.