Mouse Anti-POLD4 (DNA Polymerase delta Subunit 4, DNA Polymerase delta Subunit p12, POLDS)
Required for optimal DNA polymerase delta activity. May contribute to PCNA-dependent activity of DNA polymerase delta.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length recombinant corresponding to aa1-35 from human POLD4 (AAH01334) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in ascites fluid.
Specificity
Recognizes human POLD4.