POLR2A (DNA-directed RNA Polymerase II subunit RPB1; also subunit A) is a 200-220kD member of the RNA polymerase beta-chain family of proteins. It is ubiquitously expressed and represents the largest subunit of RNA polymerase II, the catalytic mechanism for the synthesis of mRNA. Human POLR2A is 1970aa in length. It contains an N-terminus with six RNA polymerase domains (aa15-1079), and a C-terminus (CTD) with 52 seven aa repeats (-YSPTSPS-) that serve as a platform for polymerase subunit interaction. When these sequences are hyperphosphorylated, this subunit is called RNA pol IIo; when hypophosphorylated, the subunit becomes RNA pol IIa. Isoforms exist that show a 60aa substitution for aa1-95, a 24aa substitution for aa1-445, and an Arg substitution for aa1498-1536. Full-length human and mouse POLR2A sequences differ by only one amino acid (Thr1856Ala).

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCV

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa1-111 from human POLR2A (NP_000928) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.

Purified by Protein A affinity chromatography.

Recognizes human POLR2A.