Mouse Anti-POLR2A (DNA-directed RNA Polymerase II Subunit RPB1, RNA Polymerase II Subunit B1, DNA-directed RNA Polymerase II Subunit A, DNA-directed RNA Polymerase III Largest Subunit, RNA-directed RNA Polymerase II Subunit RPB1, POLR2, MGC75453)
POLR2A (DNA-directed RNA Polymerase II subunit RPB1; also subunit A) is a 200-220kD member of the RNA polymerase beta-chain family of proteins. It is ubiquitously expressed and represents the largest subunit of RNA polymerase II, the catalytic mechanism for the synthesis of mRNA. Human POLR2A is 1970aa in length. It contains an N-terminus with six RNA polymerase domains (aa15-1079), and a C-terminus (CTD) with 52 seven aa repeats (-YSPTSPS-) that serve as a platform for polymerase subunit interaction. When these sequences are hyperphosphorylated, this subunit is called RNA pol IIo; when hypophosphorylated, the subunit becomes RNA pol IIa. Isoforms exist that show a 60aa substitution for aa1-95, a 24aa substitution for aa1-445, and an Arg substitution for aa1498-1536. Full-length human and mouse POLR2A sequences differ by only one amino acid (Thr1856Ala).
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCV
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa1-111 from human POLR2A (NP_000928) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human POLR2A.
