Mouse Anti-PPARGC1A (Peroxisome Proliferator-activated Receptor gamma Coactivator 1-alpha, PGC-1-alpha, PPAR-gamma Coactivator 1-alpha, PPARGC-1-alpha, Ligand Effect Modulator 6, LEM6, PGC1, PGC1A, PPARGC1)
PGC1 beta (peroxisome proliferator-activated receptor gamma coactivator 1 beta), also known as PPARGC1B, is an 110kD protein that belongs to a family of PPAR coactivators. It coactivates nuclear receptors such as ERRalpha, upregulating expression of proteins that promote mitochondrial fusion and control basal mitochondrial biogenesis. N- and C-terminal alternate sequences, or deletion of aa156-194, produce isoforms of 984, 1017, 1023 (most common) and 1055aa. Human PGC1 beta aa315-420, which is common to all isoforms, shares 79% and 76% aa identity with mouse and rat PGC1 beta, respectively.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa689-798 from human PPARGC1A (NP_037393) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human PPARGC1A.