131722-Biotin
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
BiotinIsotype
IgG2a,kClone Number
3G9Grade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
NM_002719, NP_002710.2Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-PPP2R5C (KIAA0044, Serine/Threonine-protein Phosphatase 2A 56kD Regulatory Subunit gamma Isoform, PP2A B Subunit Isoform B'-gamma, PP2A B Subunit Isoform B56-gamma, PP2A B Subunit Isoform PR61-gamma, PP2A B Subunit Isoform R5-gamma, Renal Carcinoma Antigen NY-REN-29, MGC23064) (Biotin)
The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFA
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human PPP2R5C (NP_002710.2) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human PPP2R5C.