131749-ML650
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™650Isotype
IgG1,kClone Number
4E10-2D2Grade
Affinity PurifiedApplications
FLISA IF IHC WBCrossreactivity
HuAccession #
BC000452, AAH00452Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-PRDX2 (Peroxiredoxin-2, Thioredoxin Peroxidase 1, Thioredoxin-dependent Peroxide Reductase 1, Thiol-specific Antioxidant Protein, TSA, PRP, Natural Killer Cell-enhancing Factor B, NKEF-B, TDPX1, NKEFB, MGC4104) (MaxLight 650)
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
Peroxiredoxin 2 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. It may play an antioxidant protective role in cells, and it may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression.
Applications
Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-199 from human PRDX2 (AAH00452) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human PRDX2.