131758-FITC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
FITCIsotype
IgG2a,kClone Number
3E6Grade
Affinity PurifiedApplications
FLISACrossreactivity
HuAccession #
NM_012094, NP_036226Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-PRDX5 (Peroxiredoxin-5, Mitochondrial, Peroxiredoxin V, Prx-V, Peroxisomal Antioxidant Enzyme, PLP, Thioredoxin Reductase, Thioredoxin Peroxidase PMP20, Antioxidant Enzyme B166, AOEB166, TPx Type VI, Liver Tissue 2D-page Spot 71B, Alu Corepressor 1, SBBI10, ACR1) (FITC)
PRDX5 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. This protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution.
Applications
Suitable for use in FLISA. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
LPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL*
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa105-215 from human PRDX5 (NP_036226) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human PRDX5.
