Mouse Anti-PTF1A (Pancreas Transcription Factor 1 Subunit alpha, Pancreas-specific Transcription Factor 1a, Class A Basic Helix-loop-helix Protein 29, bHLHa29, bHLH Transcription Factor p48, p48 DNA-binding Subunit of Transcription Factor, PTF1, PTF1P48, PTF1-p48)
Applications
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody. Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml detects PTF1A using immunoperoxidase staining on formalin fixed paraffin embedded human esophagus. Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
QAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS*
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa250-329 from human PTF1A (NP_835455) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human PTF1A.