132084-ML550
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™550Isotype
IgG2a,kClone Number
3F4Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
BC035960, AAH35960Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-PTPRU (Receptor-type Tyrosine-protein Phosphatase U, R-PTP-U, Pancreatic Carcinoma Phosphatase 2, PCP-2, Protein-tyrosine Phosphatase J, PTP-J, hPTP-J, Protein-tyrosine Phosphatase pi, PTP pi, Protein-tyrosine Phosphatase Receptor omicron, PTP-RO, Receptor-type Protein-tyrosine Phosphatase psi, R-PTP-psi, FMI, PCP2, PTPRO) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
PTP-U, a member of the receptor class 2B subfamily of protein-tyrosine phosophatases, is involved in regulation of processes involving cell contact and adhesion such as growth control, tumor invasion, and metastasis. It forms complexes with beta-catenin and gamma-catenin/plakoglobin. This Type I membrane protein is found at high levels in brain, pancreas, and skeletal muscle; less in colon, kidney, liver, stomach, and uterus; no expression is observed in placenta and spleen. PTP-U is up-regulated upon cell contact. The protein contains 4 fibronectin type III domains, 1 immunoglobulin-like C2-type domain, 1 MAM domain, and 2 protein-tyrosine phosphatase domains.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MGHLPTGIHGARRLLPLLWLFVLFKNATAFHVTVQDDNNIVVSLEASDVISPASVYVVKITGESKNYFFEFEEFNSTLPPPVIFKASYHGLYYIITLVVVNGNVVTKPSRSITVLTKPLPVTSVSIYDYKPSPETGVLFEIHYPEKYNVFTRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATFNKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWPDFNSSDYETTSQPYWWDSASAAPESEDEFVSVLPMEYENNSTLSETEKSTSGSFSFFPVQMILTWLPPKPPTAFDGFHIHIEREENFTEYLMVDEEAHEFVAELKEPGKYKLSVTTFSSSGSCETRKSQSAKSLSFYISPSGEWIEELTEKPQHVSVHVLSSTTALMSWTSSQENYNSTIVSVVSLTCQKQKESQRLEKQYCTQVNSSKPIIENLVPGAQYQVVIYLRKGPLIGPPSDPVTFAIVPTGIKDLMLYPLGPTAVVLSWTRPYLGVFRKYVVEMFYFNPATMTSEWTTYYEIAATVSLTASVVIFP
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to human PTPRO, aa1-598 (AAH35960) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human PTPRO.
