132327-HRP
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
HRPIsotype
IgG2a,kClone Number
1H5Grade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
BC009678, AAH09678Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-RARRES3 (Retinoic Acid Receptor Responder Protein 3, RAR-responsive Protein TIG3, Retinoid-inducible Gene 1 Protein, Tazarotene-induced Gene 3 Protein, RIG1, TIG3, MGC8906) (HRP)
RARRES3 also called Tig3 or RIG1 is an 18kD, 164aa cytoplasmic protein within the LRAT family of growth inhibitory proteins, which are class II tumor-suppressors. RARRES3 is expressed in a variety of cells including epidermal keratinocytes, and may be downregulated in tumor cells and cell lines. It shows phospholipase activity and interaction with type I transglutaminase. A C-terminal hydrophobic region allows perinuclear localization. RARRES3 is not structurally related to other RARRES genes. A canine ortholog shares 72% aa identity within the region used as an immunogen; orthologs are unlikely in rodents.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to human RARRES3, aa1-165 (AAH09678) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human RARRES3.
