Mouse Anti-RBM39 (HCC1, RNPC2, RNA-binding Protein 39, Hepatocellular Carcinoma Protein 1, RNA-binding Motif Protein 39, RNA-binding Region-containing Protein 2, Splicing Factor HCC1)
The protein encoded by this gene is an RNA binding protein and possible splicing factor. The encoded protein is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. Multiple transcript variants encoding different isoforms have been observed for this gene.
Applications
Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot. Other applications not tested.
Recommended Dilutions
Immunofluorescence: 40ug/ml Immunohistochemistry (FFPE): 1ug/ml Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa423-472 from human RBM39 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human RBM39. Species Crossreactivity: mouse.