132487
Clone Type
MonoclonalHost
MouseSource
HumanIsotype
IgG3,kClone Number
3F8Grade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
BC051786, AAH51786Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeMouse Anti-RFC1 (RFC140, Replication Factor C Subunit 1, Activator 1 140kD Subunit, Activator 1 Large Subunit, Activator 1 Subunit 1, DNA-binding Protein PO-GA, Replication Factor C 140kD Subunit, Replication Factor C Large Subunit, MGC51786)
The protein encoded by this gene is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability. [provided by RefSeq].
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISET
Storage and Stability
May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.
Immunogen
Partial recombinant corresponding to aa1-110, from human RFC1 (AAH51786) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human RFC1.
