Rabbit Anti-RGS20 (Regulator of G-protein Signaling 20, Gz-selective GTPase-activating Protein, G(z)GAP, Gz-GAP, Regulator of G-protein Signaling Z1, Regulator of Gz-selective Protein Signaling 1, RGSZ1, ZGAP1)
RGS proteins are regulatory and structural components GPCR complexes. These are GAPs for Gi and Gq class G-alpha proteins and negatively regulate GPCR signaling pathways. RGS20, a 25kD protein, is a novel member of this family and is human homolog of bovine Gz-GAP. It contains an N-terminal cysteine string that is potential site for multiple palmitoylation and a C-terminal RGS core domain. RGS20 plays a vital role in regulating GPCR signals in brain, neuronal development and regulation of golgi structure. It specifically interacts and accelerates the hydrolysis of G-alphaz. Reports suggest that it interacts with G-alphai subunit and plays a significant role in regulation of G-alphai-mediated signaling. It is a membrane-bound protein specifically expressed in brain, with highest concentrations in caudate nucleus and temporal lobe.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human RGS20, aa1-241 (NP_003693.2).
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human RGS20. Species Crossreactivity: mouse.