Mouse Anti-RIN1 (Ras and Rab Interactor 1, Ras Interaction/Interference Protein 1, Ras Inhibitor JC99) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
RIN1 (Ras and Rab interactor 1 or Ras interaction:interference 1) is identified as a Ras effector protein based on its ability to block Ras induced cell death. The protein binds GTP-Ras, Bcr-Abl, and 14-3-3. It is composed of several functional domains: SH2 and proline-rich domains in the N-terminal region and Vps9 and Ras association domains in the C-terminal region. Recent studies have shown that through its interaction with Abl tyrosine kinase, RIN1 mediates actin cytoskeleton remodeling associated with migration and adhesion of epithelial cells. The protein also regulates EGF-induced signal transduction. It is highly expressed in brain, placenta and pancreas. Human RIN1 gene is localized in the chromosomal region 11q13.1.
Applications
Suitable for use in FLISA. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
VPPEASIATLNQLCATKFRVTQPNTFGLFLYKEQGYHRLPPGALAHRLPTTGYLVYRRAEWPETQGAVTEEEGSGQSEARSRGEEQGCQGDGDAGVKASPRDIREQSETT
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa646-755 from RIN1 (AAH14417) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human RIN1.