132631-ML650
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™650Isotype
IgG2a,kClone Number
1C4Grade
Affinity PurifiedApplications
FLISA IF WBCrossreactivity
HuAccession #
NM_017610, NP_060080Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-RING Finger Protein 111 (RNF111, E3 Ubiquitin-protein Ligase Arkadia, ARK) (MaxLight 650)
EC=6.3.2.-, DKFZp313E0731, DKFZp686H1966, DKFZp761D081, FLJ38008
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
Applications
Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDDSQKQEKEMNGNQQEQEKSLVVRKKRKSQQAGPSYVQNC
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-109 from human RNF111 (NP_060080) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human RNF111.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
1. RB1CC1 positively regulates transforming growth factor-{beta} signaling through the modulation of Arkadia E3 ubiquitin ligase activity. Koinuma D, Shinozaki M, Nagano Y, Ikushima H, Horiguchi K, Goto K, Chano T, Saitoh M, Imamura T, Miyazono K, Miyazawa K.J Biol Chem. 2011 Jul 27. 2. Efficient TGF-beta/SMAD signaling in human melanoma cells associated with high c-SKI/SnoN expression. Javelaud D, van Kempen L, Alexaki VI, Le Scolan E, Luo K, Mauviel A.Mol Cancer. 2011 Jan 6;10(1):2. 3. Context-dependent regulation of the expression of c-Ski protein by Arkadia in human cancer cells. Nagano Y, Koinuma D, Miyazawa K, Miyazono K.J Biochem. 2010 Apr;147(4):545-54. Epub 2009 Dec 2. 4. Overexpression of snon/skil, amplified at the 3q26.2 locus, in ovarian cancers: a role in ovarian pathogenesis. Nanjundan M, Cheng KW, Zhang F, Lahad J, Kuo WL, Schmandt R, Smith-McCune K, Fishman D, Gray JW, Mills GB.Mol Oncol. 2008 Aug;2(2):164-81. Epub 2008 May 10. 5. Arkadia activates Smad3/Smad4-dependent transcription by triggering signal-induced SnoN degradation. Levy L, Howell M, Das D, Harkin S, Episkopou V, Hill CS.Mol Cell Biol. 2007 Sep;27(17):6068-83. Epub 2007 Jun 25.USBio References
No references available