ROCK-1 (Rho-associated coiled coil-containing protein kinase 1) has been found to be a new caspase-3 substrate. ROCK-1 consists of an amino-terminal kinase domain and an inhibitory cysteine/histidine-rich C-terminal domain. During apoptosis, ROCK-1 is cleaved by caspase-3 at the conserved DETD1113/G sequence and its C-terminal inhibitory domain is removed, resulting in deregulated and constitutive kinase activity. The caspase-3 mediated cleavage and activation of ROCK-1 induces phosphorylation of MLC and membrane blebbing, the early events in the execution phase of apoptosis.

Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested.

Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.

SNRRYLSSANPNDNRTSSNADKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRR

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa401-511, from human ROCK1 (NP_005397) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human ROCK1.