132724-HRP
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
HRPIsotype
IgG2a,kClone Number
4E2Grade
Affinity PurifiedApplications
ECrossreactivity
HuAccession #
NM_002447, NP_002438Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-RON (p185-Ron, CDW136, CD136, MST1R, Macrophage-stimulating Protein Receptor alpha Chain, Macrophage-stimulating Protein Receptor beta Chain, Macrophage-stimulating Protein Receptor MSPR, MSP Receptor, Protein-tyrosine Kinase 8, PTK8) (HRP)
Macrophage stimulating protein receptor, encoded by the human RON and the mouse Stk genes, is one of a family of receptor tyrosine kinases that also includes human Met. This family of receptors is synthesized as a single-chain precursor that is cleaved into a mature disulfide-linked heterodimer composed of an extracellular a chain and a membrane spanning b chain with intrinsic tyrosine kinase activity. Expression of MSP R is restricted to specific areas of the central and peripheral nervous systems, epithelial cells along the digestive tract, skin and lung, and in subpopulations of the mononuclear phagocyte lineage. Both the MSP heterodimer and the free MSP b chain have been shown to bind MSP R. However, only the MSP heterodimer can induce receptor dimerization and phosphorylation and cause biological activity.
Applications
Suitable for use in ELISA. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
DWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVL
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa26-125 from human MST1R (NP_002438) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MST1R.