Macrophage stimulating protein receptor, encoded by the human RON and the mouse Stk genes, is one of a family of receptor tyrosine kinases that also includes human Met. This family of receptors is synthesized as a single-chain precursor that is cleaved into a mature disulfide-linked heterodimer composed of an extracellular a chain and a membrane spanning b chain with intrinsic tyrosine kinase activity. Expression of MSP R is restricted to specific areas of the central and peripheral nervous systems, epithelial cells along the digestive tract, skin and lung, and in subpopulations of the mononuclear phagocyte lineage. Both the MSP heterodimer and the free MSP b chain have been shown to bind MSP R. However, only the MSP heterodimer can induce receptor dimerization and phosphorylation and cause biological activity.

Suitable for use in FLISA. Other applications not tested.

Optimal dilutions to be determined by the researcher.

DWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVL

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa26-125 from human MST1R (NP_002438) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.

Purified by Protein A affinity chromatography.

Recognizes human MST1R.