RORg (Nuclear receptor ROR-gamma) is a member of the NR1 nuclear hormone receptor family. RORg is a DNA binding transcription factor. RORg is 518aa in length. Kockout mice implicate RORg as being essential for lymphoid organogenesis and controlling apoptosis during thymopoiesis. Two splice forms differing in the first 24aa have been found for this gene, isoform 2 deletes aa1-21 resulting in an alteration of aa22-24. Over aa1-100 human RORC shares 96% identity with mouse RORg.

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

FSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLS

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa412-518, from human RORC (NP_005051) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human RORC.