132864-HRP
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
HRPIsotype
IgG2b,kClone Number
4E11Grade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
BC014966, AAH14966Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-RSK1 (Ribosomal S6 Kinase 1, RSK-1, 90kD Ribosomal Protein S6 Kinase 1, p90-RSK 1, p90RSK1, p90S6K, MAP Kinase-activated Protein Kinase 1a, MAPK-activated Protein Kinase 1a, MAPKAP Kinase 1a, MAPKAPK1A, MAPKAPK-1a, Ribosomal Protein S6 Kinase alpha-1, RPS6KA1, S6K-alpha-1) (HRP)
RSK1 is an RSK serine/threonine kinase. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEM
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-736 from human RPS6KA1 (AAH14966) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human RPS6KA1.