132914-APC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
APCIsotype
IgG1,kClone Number
4D2-F1Grade
Affinity PurifiedApplications
FLISA IF WBCrossreactivity
HuAccession #
BC015973, AAH15973Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
BSA Free
Mouse Anti-S100A10 (Protein S100-A10, Calpactin I Light Chain, Calpactin-1 Light Chain, Cellular Ligand of Annexin II, S100 Calcium-binding Protein A10, p10 Protein, p11, ANX2LG, CAL1L, CLP11, MGC111133) (APC)
S100A10/p11 belongs to the S-100 calcium binding protein family, although it has had crucial aa substitutions and deletions that render it incapable of binding calcium. p11 forms a heterotetrameric complex with annexin II. p11 functions as an auxiliary protein and has been shown to interact directly the potassium channel TASK-1. It is essential for TASK1 trafficking to the plasma membrane. p11 also increases the localization of 5HT1B receptors to the cell surface.
Applications
Suitable for use in FLISA, Western Blot and Immunofluorescence. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK*
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-98 from human S100A10 (AAH15973) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human S100A10.