Mouse Anti-S100A2 (S100L, CaN19, Protein S100-A2, Protein S-100L, S100 Calcium-binding Protein A2) (APC)
S100A2 is a 10kD member of the S100 family, EF-hand superfamily of Ca-binding proteins. It is expressed by multiple cell types, including keratinocytes, chondrocytes, and bronchial epithelium. S100A2 regulates both Ca and Zn (in human) within cells, and increases p53 activity. It forms both noncovalent and covalent homodimers, and a homotetramer under certain conditions. Human S100A2 is 98aa in length. It contains two EF-hand motifs (aa13-48 and 51-86) plus a calcium (aa64-75) and zinc (aa17-22) binding site. There is one potential alternative splice form that shows a 40aa insertion after Gly48. Full-length human S100A2 shares 89%, 85% aa identity with bovine and canine S100A2, respectively.
Applications
Suitable for use in FLISA, Western Blot and Immunofluorescence. Other applications not tested.
Recommended Dilution
Immunofluorescence: 15ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP*
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-98 from human S100A2 (AAH02829) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human S100A2.
