132933-FITC
Clone Type
PolyclonalHost
RabbitSource
HumanConjugate
FITCIsotype
IgGGrade
Affinity PurifiedApplications
WBCrossreactivity
HuAccession #
NM_002965.2, NP_002956.1Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Rabbit Anti-S100A9 (S100 Calcium Binding Protein A9, 60B8AG, Calgranulin B, CAGB, Calprotectin L1H Subunit, CFAG, CGLB, Cystic Fibrosis Antigen, L1AG, Leukocyte L1 Complex Heavy Chain, LIAG, MAC387, Migration Inhibitory Factor-related Protein 14, MIF Related Protein 14, MRP14, MRP-14, NIF, P14, Protein S100-A9) (FITC)
S100 Calcium Binding Protein A9, also known as Calgranulin B, belongs to the S100 family containing EF-hand type Ca2+-binding proteins. It is involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation, and associated with the disease cystic fibrosis. S100A9 has been implicated in the abnormal differentiation of myeloid cells in the stroma of cancer. This protein may function in the inhibition of casein kinase.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length human S100A9, aa1-114 (NP_002956.1).
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human S100A9.