133024-FITC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
FITCIsotype
IgG1,kClone Number
2G11-C12Grade
Affinity PurifiedApplications
FLISACrossreactivity
HuAccession #
BC036793, AAH36793Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-SCN2B (Sodium Channel Subunit beta-2, UNQ326/PRO386) (FITC)
Scn2b encodes one type of beta subunit found in voltage-gated sodium channels. These channels, composed of one alpha and one or two different beta subunits, mediate changes in cell permeability to sodium ions that are essential for the generation of action potentials. Scn2b protein, comprised of an extracellular N-terminus with an immunoglobulin-like fold and a single transmembrane domain, has been shown in brain tissues to be covalently linked through disulfide bonds to the alpha subunit. Scn2b is considered an auxiliary subunit that modulates cell-surface expression and gating, though its function in heart myocytes may be limited to cell adhesion. Scnb2 null mice display increased susceptibility to seizures. Expression of Scn2b has been shown to be suppressed with exposure to pneumococcal acute otitis media.
Applications
Suitable for use in FLISA. Other applications not tested.
Recommended Dilutions
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-215 from human SCN2B with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SCN2B.
