Mouse Anti-SERTAD1 (SERTA Domain-containing Protein 1, CDK4-binding Protein p34SEI1, SEI1, SEI-1, Transcriptional Regulator Interacting with the PHD-bromodomain 1, TRIP-Br1)
Transcriptional regulator interacting with the PHD-bromodomain 1, TRIP-Br1, CDK4-binding protein p34SEI1, SEI-1.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
ELISA: 1ng/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MLSKGLKRKREEEEEKEPLAVDSWWLDPGHTAVAQAPPAVASSSLFDLSVLKLHHSPQQSEPDLRHLVLVVNTLRRIQASMAPAAALPPVPSPPAAPSVADNLLASSDAALSASMASLLEDLSHIEGLSQAPQPLADEGPPGRSIGGAAPSLGALDLLGPATGCLLDDGLEGLFEDIDTSMYDNELWAPASEGLKPGPEDGPGKEEAPELDEAELDYLMDVLVGTQALERPPGPGR*
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full-length recombinant corresponding to aa1-237 from human SERTAD1 (AAH02670) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SERTAD1.