133201-ML650
Clone Type
PolyclonalHost
RabbitSource
HumanConjugate
MaxLight™650Isotype
IgGGrade
Affinity PurifiedApplications
WBCrossreactivity
HuAccession #
NM_000331.2, NP_000322.2Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Rabbit Anti-Serum Amyloid A1 (SAA1, Amyloid Fibril Protein AA, Amyloid Protein A, MGC111216, PIG4, SAA2, Serum Amyloid A Protein Precursor, SAA, Tumor Protein p53 Inducible Protein 4, TP53I4) (MaxLight 650)
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
Human Serum Amyloid A protein-1 (SAA-1) is a multifunctional apolipoprotein produced by hepatocytes in response to proinflammatory cytokines. It is secreted as a 12kD, 104aa, nonglycosylated polypeptide that displaces apoA1 in the HDL 3 complex. The SAA-1 gene is one of three SAA genes in human, and it shows multiple alleles that are race dependent. The SAA-1 gene product differs from the SAA-2 gene product by only seven amino acids. Circulating SAA-1 shows multiple proteolytically-generated isoforms, with anywhere from one-to-three amino acids being cleaved from either the N- or C-terminus.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length human SAA1, aa1-122 (NP_000322.2).
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SAA1.