Mouse Anti-SIN3B (Paired Amphipathic Helix Protein Sin3b, Histone Deacetylase Complex Subunit Sin3b, KIAA0700, Transcriptional Corepressor Sin3b)
Applications
Suitable for use in ELISA. Other applications not tested.
Recommended Dilution
ELISA: 3 ng/ml Optimal dilutions to be determined by the researcher.
AA Sequence
HKMVFIVNSEDYMYRRGTLCRAKQVQPLVLLRHHQHFEEWHSRWLEDNVTVEAASLVQDWLMGEEDEDMVPCKTLCETVHVHGLPVTRYRVQYSRRPA*
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa1063-1161 from SIN3B (NP_056075) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SIN3B.