Mouse Anti-SLA (Src-like-adapter, Src-like-adapter Protein 1, SLAP, hSLAP, SLA1, SLAP1, SLAP-1)
SLAP also known as Src-like-adapter protein 1 is a 276aa containing adapter protein, functioning as a negative regulator of T-cell receptor (TCR) signaling. SLAP belonging to the SRC family of cytoplasmic tyrosine kinases contains a SH2 domain and a SH3 domain. This cytoplasmic protein colocalizes with endosomes and is known to inhibit T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. It acts as a negative regulator of positive selection and mitosis of T-cells. SLAP may act by linking signaling proteins such as ZAP70 with CBL, leading to a CBL dependent degradation of signaling proteins. Expression of SLAP is weak in heart, adult brain, placenta, liver, skeletal muscle, kidney and pancreas but is high in lung and fetal brain.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQSTAAPAVRASSSPVTLRQKTVDWRRVSRLQEDPEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGGSKRKSSFFSSPPYFED
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human SLA, aa1-276 (NP_006739.1).
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SLA.
