Mouse Anti-SLC27A1 (Solute Carrier Family 27 Member 1, ACSVL5, Long-chain Fatty Acid Transport Protein 1, Fatty Acid Transport Protein 1, FATP1, FATP-1, FATP)
EC=6.2.1.-
Applications
Suitable for use in ELISA. Other applications not tested.
Recommended Dilution
Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
LRIVCKTARRDLFGLSVLIRVRLELRRHQRAGHTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLFRQLGFAPGDVVAIFLEG*
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa44-138 from human SLC27A1 (NP_940982) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SLC27A1.