Mouse Anti-SLC29A4 (Solute Carrier Family 29 Member 4, Equilibrative Nucleoside Transporter 4, ENT4, hENT4, Plasma Membrane Monoamine Transporter, PMAT, PSEC0113)
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Sandwich ELISA: The detection limit for recombinant GST tagged SLC29A4 is ~0.3ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
VHHDVVAGDVHFEHPAPAPAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLH
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa283-346 from human SLC29A4 (NP_694979) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SLC29A4. Species Crossreactivity: rat.
