Synuclein, gamma is a 127aa protein (~14kD) which belongs to the synuclein family, which also includes alpha- and beta- synuclein. Three synucleins are located in the neuronal cytosol and enriched in presynaptic terminals, while SYN is also expressed in many other non-neuronal tissues. SYN is abnormally expressed in a high percentage of tumor tissues of diversified cancer types, including liver, esophagus, colon, gastric, lung, prostate, cervical, and breast cancer, but rarely expressed in tumor-matched nonneoplastic adjacent tissues. High levels of SYN have been identified in advanced breast carcinomas suggesting a correlation between overexpression of SYN and breast tumor development.

Suitable for use in Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Full length human SNCG, aa1-127 (AAH14098.1).

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.

Purified by Protein A affinity chromatography.

Recognizes human SNCG.