133709-HRP
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
HRPIsotype
IgG2b,kClone Number
3F2Grade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
NM_003105, NP_003096Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-SORL1 (Sortilin-related Receptor, Low-density Lipoprotein Receptor Relative with 11 Ligand-binding Repeats, LDLR Relative with 11 Ligand-binding Repeats, LR11, SorLA-1, Sorting Protein-related Receptor Containing LDLR class A Repeats, C11orf32) (HRP)
SORL1 is likely to be a multifunctional endocytic receptor, that may be implicated in the uptake of lipoproteins and of proteases. It binds LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. SORL1 binds the receptor-associated protein (RAP). It could play a role in cell-cell interaction. SORL1 is expressed mainly in brain, where it is most abundant in the cerebellum, cerebral cortex and the occipital pole; low expression in the putamen and the thalamus. It is also found in spinal cord, testis, liver, kidney and pancreas with detectable levels in placenta, lung and heart. Moreover, it is expressed in the prostate, ovary, thyroid and spleen, but not found in kidney, liver, lung, skeletal muscle, bone marrow and adrenals.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
SAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFAD*
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa82-182 from human SORL1 (NP_003096) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SORL1.