134000-HRP
Clone Type
PolyclonalHost
RabbitSource
HumanConjugate
HRPIsotype
IgGGrade
Affinity PurifiedApplications
WBCrossreactivity
Hu MoAccession #
NM_005563, NP_005554.1Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Rabbit Anti-STMN1 (Stathmin, Leukemia-associated Phosphoprotein p18, Metablastin, Oncoprotein 18, Op18, Phosphoprotein p19, pp19, Prosolin, Protein Pr22, pp17, C1orf215, LAP18, OP18) (HRP)
Stathmin 1, a neuron-enriched soluble phosphoprotein is a ubiquitous, phylogenetically conserved protein present in the cytoplasm of cells in a variety of unphosphorylated and phosphorylated forms. Stathmin 1 is widely expressed in organisms ranging from Drosophila to humans and is especially highly expressed in the developing nervous system. Its expression is also elevated in a number of leukemias and solid tumors, which has led to the suggestion that it may be involved in tumorigenesis. The protein destabilizes microtubules and increases the frequency by which microtubule plus ends switch from growth to rapid shortening and thus plays an important role in linking cell signaling to the regulation of microtubule dynamics. Human Stathmin 1 has been mapped to chromosomal region 1p36.1-p35.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length human STMN1, aa1-149 (NP_005554.1).
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human STMN1. Species Crossreactivity: mouse.