Mouse Anti-Tenascin (TN, Tenascin-C, TNC, TN-C, 150-225, Cytotactin, Glioma-associated Extracellular Matrix Antigen, GMEM, GP 150-225, Hexabrachion, HXB, JI, MGC167029, Myotendinous Antigen, Neuronectin)
Tenascin is a hexameric extracellular matrix protein. Tenascin may have a role in guiding migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. In the embryo, Tenascin is found in developing epithelia, cartilage and bone. In the adult, Tenascin is found in smooth muscle, tendon and hyper-proliferative skin. At least 6 isoforms of human Tenascin are produced by alternative splicing.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Sandwich ELISA: The detection limit is ~10ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher.
Amino Acid Sequence: KGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYN
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa181-290 from human TNC (NP_002151) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human TNC.