134594-FITC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
FITCIsotype
IgG2b,kClone Number
2F2-1A7Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
BC038957, AAH38957Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-TOB2 (Protein Tob2, Transducer of erbB-2 2, Protein Tob4, KIAA1663, TOB4, TOBL, TROB2) (FITC)
TOB2 is a 344aa rich novel member of the Tob:BTG1 anti-proliferative family of proteins characterized by similarities in their N-terminal BTG:Tob homology domains. This anti-proliferative protein inhibits cell cycle progression from the G0:G1 to S phases and is involved in cell cycle regulation through interaction with Caf1, a component of the CCR4 transcription factor complex that associates with cyclin-dependent kinases. Recent reports suggest that TOB2 plays important roles in spermatogenesis, embryonic dorsoventral patterning, osteogenesis, T-cell activation, learning and memory and acts primarily as a transcriptional repressor in several signaling pathways. TOB2, a signaling protein, may participate in transcriptional regulation of several genes. It is a regulatory protein ubiquitously expressed in most of the tissues.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVKVLYLDDSEGCGAPELDKEIKSSFNPDAQVFVPIGSQDSSLSNSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGGAASGGGVASSGAGGQQPPQQPRMARSPTNSLLKHKSLSLSMHSLNFITANPAPQSQLSPNAKEFVYNGGGSPSLFFDAADGQGSGTPGPFGGSGAGTCNSSSFDMAQVFGGGANSLFLEKTPFVEGLSYNLNTMQYPSQQFQPVVLAN
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-344 from human TOB2 (AAH38957) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human TOB2.
