134771-APC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
APCIsotype
IgG2a,kClone Number
2G1Grade
Affinity PurifiedApplications
FLISA IPCrossreactivity
HuAccession #
NM_001008274, NP_001008275.1Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
BSA Free
Mouse Anti-TRIM72 (Tripartite Motif-containing Protein 72, Mitsugumin-53, Mg53, MG53) (APC)
Muscle-specific protein that plays a central role in cell membrane repair by nucleating the assembly of the repair machinery at injury sites. Specifically binds phosphatidylserine. Acts as a sensor of oxidation: upon membrane damage, entry of extracellular oxidative environment results in disulfide bond formation and homooligomerization at the injury site. This oligomerization acts as a nucleation site for recruitment of TRIM72-containing vesicles to the injury site, leading to membrane patch formation. Probably acts upstream of the Ca2+-dependent membrane resealing process. Required for transport of DYSF to sites of cell injury during repair patch formation. Regulates membrane budding and exocytosis. May be involved in the regulation of the mobility of KCNB1-containing endocytic vesicles.
Applications
Suitable for use in FLISA and Immunoprecipitation. Other applications not tested.
Recommended Dilution
Sandwich FLISA: The detection limit is ~0.1ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
QGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGAEA*
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa378-478 from human TRIM72 (NP_001008275) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human TRIM72.
