134991-ML550
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™550Isotype
IgG2a,kClone Number
4A1Grade
Affinity PurifiedApplications
FLISA IHC WBCrossreactivity
Hu Mo RtAccession #
NM_003339, NP_003330Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-UBE2D2 (Ubiquitin-conjugating Enzyme E2 D2, UBC4, UBC5B, UBCH4, UBCH5B, Ubiquitin Carrier Protein D2, Ubiquitin-conjugating Enzyme E2(17)KB 2, Ubiquitin-conjugating Enzyme E2-17kD 2, Ubiquitin-protein Ligase D2, p53-regulated Ubiquitin-conjugating Enzyme 1, PUBC1) (MaxLight 550)
EC=6.3.2.19, UBC4/5, E2(17)KB2
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Applications
Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWS
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-94 from human UBE2D2 (NP_003330) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human UBE2D2. Species Crossreactivity: mouse and rat.