135030-PE
Clone Type
PolyclonalHost
RabbitSource
HumanConjugate
PEIsotype
IgGGrade
Affinity PurifiedApplications
WBCrossreactivity
HuAccession #
NM_014235.2, NP_055050.1Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
BSA Free
Rabbit Anti-UBL4A (Ubiquitin-Like 4A, DX254E, DXS254E, G6PD, GDX, UBL4) (PE)
The UBL4 gene lies in a ubiquitiously transcribed region on the X chromosome approximately 40kb downstream of glucose-6-phosphate dehydrogenase (G6PD). The UBL4 gene, which encodes for a 157aa protein, is consistent with the characteristics of a housekeeping gene, since transcripts are detected a multiple cell types, and the protomoter region is rich in GC sequences and lacks signals such as TATA and CAT boxes. The UBL4 protein bears strong similarity in its 72 N-terminal aa to ubiquitin. In the middle of the C-terminus moiety of the UBL4 protein, similarities to the thyroglobulin hormonogenic site, the sequence that surrounds the tyrosines that will form thyroxine, have been demonstrated. It has been inferred from these data that the UBL4 protein plays an important role in essential cellular functions.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length human UBL4A, aa1-157 (NP_055050.1).
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human UBL4A.
