Mouse Anti-UCRC (Ubiquinol-cytochrome c Reductase Complex 7.2kD Protein, UQCR10, Cytochrome b-c1 Complex Subunit 9, Complex III Subunit 9, Complex III Subunit X, Cytochrome c1 Non-heme 7kD Protein, HSPC119) (PE)
QCR9, HSPC051, HSPC151, UCCR7.2
Applications
Suitable for use in FLISA. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK*
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-64 from UCRC (AAH05402) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human UCRC.
