Mouse Anti-UCRC (Ubiquinol-cytochrome c Reductase Complex 7.2kD Protein, UQCR10, Cytochrome b-c1 Complex Subunit 9, Complex III Subunit 9, Complex III Subunit X, Cytochrome c1 Non-heme 7kD Protein, HSPC119)
QCR9, HSPC051, HSPC151, UCCR7.2
Applications
Suitable for use in ELISA. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK*
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full-length recombinant corresponding to aa1-64 from UCRC (AAH05402) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human UCRC.
