135543-FITC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
FITCIsotype
IgG1,kClone Number
3B1Grade
Affinity PurifiedApplications
FLISA IF WBCrossreactivity
HuAccession #
NM_006885, NP_008816Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-ZFHX3 (Zinc Finger Homeobox Protein 3, AT Motif-binding Factor, AT-binding Transcription Factor 1, Alpha-fetoprotein Enhancer-binding Protein, Zinc Finger Homeodomain Protein 3, ZFH-3, ATBF1) (FITC)
ATBF1 is a transcription factor that negatively regulates alpha fetoprotein and MYB, transactivates CDKN1A, and may be a tumor suppressor. Loss of ATBF1 is one mechanism that defines the absence of growth control in prostate cancer. Presence of the isoform ABTF1-A is correlated with better prognosis in breast cancer and may also serve as a marker of endocrine responsiveness.
Applications
Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested.
Recommended Dilutions
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
EDFESPSMSSVNLNFDQTKLDNDDCSSVNTAITDTTTGDEGNADNDSATGIATETKSSSAPNEGLTKAAMMAMSEYEDRLSSGLVSPAPSFYSKEYDNEG
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2811-2910 from human ZFHX3 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ZFHX3.
