Mouse Anti-ZNF3 (Zinc Finger Protein 3, Zinc Finger Protein HF.12, Zinc Finger Protein HZF3.1, Zinc Finger Protein KOX25, A8-51, HF.12, KOX25, PP838, Zfp113)
Applications
Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested.
Recommended Dilutions
Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
METQADLVSQEPQALLDSALLSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYFIRKEWKRLEPAQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHG
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa1-110 from human ZNF3 (NP_060185.1) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Specificity
Recognizes human ZNF3.