Rabbit Anti-CDH3 (Cadherin 3, Cadherin-3, Placental Cadherin, P-cadherin, CDHP)
CDH3 is a classical cadherin from the cadherin superfamily. The protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Its gene is located in a six-cadherin cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. In addition, aberrant expression of this protein is observed in cervical adenocarcinomas. Mutations in its gene have been associated with congential hypotrichosis with juvenile macular dystrophy.
Applications
Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Western Blot: 1.25ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher.
Storage and Stability
Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Immunogen
Synthetic peptide corresponding to AVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQ
Form
Supplied as a lyophilized powder in PBS. Reconstitute with 100ul dH2O to 1mg/ml.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes CDH3. Species Crossreactivity: Human and mouse.
