Rabbit Anti-FNTA (Protein Farnesyltransferase/Geranylgeranyltransferase Type-1 Subunit alpha, CAAX Farnesyltransferase Subunit alpha, FTase-alpha, Ras Proteins Prenyltransferase Subunit alpha, Type I Protein Geranyl-geranyltransferase Subunit alpha, GGTase-I-alpha, MGC99680) (FITC)
Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein's with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. FNTA is the alpha subunit of these transferases.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Synthetic peptide corresponding to the C-terminal region, DNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNV, of human FNTA. Species Sequence Homology: bovine, canine, equine, porcine, rabbit, rat and sheep
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human FNTA.
