Rabbit Anti-SLC46A3 (Solute Carrier Family 46 Member 3, FKSG16, DKFZp686A1775, FLJ42613)
The function of SLC46A3 protein is not widely studied, and is yet to be elucidated fully.
Applications
Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilutions
Western Blot: 2.5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher.
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Snthetic peptide corresponding to MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISEC near the N-terminus of human SLC46A3. Species Sequence Homology: mouse, rat, canine and rabbit
Form
Supplied as a liquid in PBS, 0.09% sodium azide, 2% sucrose.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SLC46A3.