Rabbit Anti-Heregulin beta-1 (Neuregulin-1, Acetylcholine Receptor-inducing Activity, Breast Cancer Cell Differentiation Factor P45, Glial Growth Factor, Heregulin, Neu Differentiation Factor, Sensory and Motor Neuron-derived Factor) (APC)
Neuregulin 1 (NRG1) was originally identified as a 44kD glycoprotein that interacts with the NEU/ERBB2 receptor tyrosine kinase to increase its phosphorylation on tyrosine residues. It is known that an extraordinary variety of different isoforms are produced from the NRG1 gene by alternative splicing. These isoforms include heregulins (HRGs), glial growth factors (GGFs) and sensory and motor neuron-derived factor (SMDF). They are tissue-specifically expressed and differ significantly in their structure. The HRG isoforms all contain immunoglobulin (Ig) and epidermal growth factor-like (EGF-like) domains. GGF and GGF2 isoforms contain a kringle-like sequence plus Ig and EGF-like domains; and the SMDF isoform shares only the EGF-like domain with other isoforms. The receptors for all NRG1 isoforms are the ERBB family of tyrosine kinase transmembrane receptors. Through interaction with ERBB receptors, NRG1 isoforms induce the growth and differentiation of epithelial, neuronal, glial, and other types of cells.
Applications
Suitable for use in FLISA, Western Blot, Immunohistochemistry and Neutralization. Other applications not tested.
Recommended Dilution
Immunohistochemistry (FFPE): Heat induced antigen retrieval with a pH 6.0 sodium citrate buffer is recommended. Optimal dilutions to be determined by the researcher.
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
EGF domain of human Heregulin beta-1.Amino Acid Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFY KHLGIEFMEAE
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Purity
Purified by immunoaffinity chromatography.
Specificity
Recognizes human Heregulin beta-1.